شرح
VEGF is a potent growth and angiogenic cytokine. It stimulates the proliferation and survival of endothelial cells and promotes angiogenesis and vascular permeability.VEGF is expressed in vascularized tissues and plays an important role in normal and pathological angiogenesis.VEGF has been implicated in tumor metastasis and in the induction of intraocular neovascularization syndromes.VEGF signals through three types of receptors; fms-like tyrosine kinase (flt-1), the KDR gene product (the murine homolog is the flk-1 gene product) and the flt4 gene product. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two polypeptide chains of 165 amino acids.
This product, Recombinant Human VEGF165, is supplied as a lyophilized powder with high activity, high purity and low endotoxin.
Specification
|
Synonyms |
Human Vascular Endothelial Growth Factor 165; MVCD1, VAS, vascular endothelial growth factor A, VEGF, VEGFA, VPF |
|
Source |
Human VEGF165 Protein is expressed from E.coli without tag. Ala27-Arg191 with an N-terminal Methionine |
|
Accession |
|
|
Molecular Weight |
Approximately 38.2 kDa. |
|
AA Sequence |
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEE SNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDS RCKARQLELNERTCRCDKPRR |
|
Endotoxin |
< 0.01 EU/μg by the LAL method. |
|
Purity |
> 96% by SDS-PAGE and HPLC. |
|
Biological Activity |
Fully biologically active when compared to standard. Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/ml. |
|
Formulation |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
|
Physical Appearance |
White lyophilized powder |
Storage
-25 ~ -15 ° C storage, valid for 1 year after receipt.
After re-solution, store at 2 ~8 °C, 7 days expiration date. After re-dissolution, store at -85~-65°C, 3 months expiration date.
Compounding Methods
Centrifuge before uncapping to bring contents to the bottom. Use sterile distilled water or PBS to re-dissolve and re-formulate to a concentration of 0.1-1.0 mg/mL, which can be diluted even further according to subsequent experiments; for long-term storage, it is recommended that carrier protein (0.1% BSA) be added to the dilution buffer; dispense for a single experimental dosage, and freeze at -80°C to avoid repeated freezing and thawing.
Cautions
1. Please operate with lab coats and disposable gloves,for your safety.
2. This product is for research use only.
پرداخت و امنیت
اطلاعات پرداخت شما با اطمینان پردازش می شود. ما جزئیات کارت اعتباری را ذخیره نمی کنیم و به اطلاعات کارت اعتباری شما دسترسی نداریم.
تحقیق
شما همچنین ممکن است دوست داشته باشید
پرسش
این محصول فقط برای اهداف تحقیقاتی است و برای استفاده درمانی یا تشخیصی در انسان یا حیوانات در نظر گرفته نشده است. محصولات و محتوا توسط پتنت ها، علائم تجاری، و حق چاپ متعلق به Yeasen Biotechnology محافظت می شوند. نمادهای علامت تجاری نشان دهنده کشور مبدا هستند، نه لزوما ثبت در همه مناطق.
برخی از برنامه‌های کاربردی ممکن است به حقوق مالکیت معنوی شخص ثالث دیگری نیاز داشته باشند.
Yeasen به علم اخلاق اختصاص داده شده است و معتقد است که تحقیقات ما باید به سؤالات مهم و در عین حال اطمینان از ایمنی و استانداردهای اخلاقی بپردازد.