Human IL-38 Protein _ 90219ES

SKU: 90219ES05

Size: 2 μg
Price:
Sale price$137.00

Shipping calculated at checkout

Stock:
In stock

Description

Interleukin 38 (IL-38) belongs to the IL-1 family and is expressed in fetal skin, spleen, and tonsils, predominantly in the basal epithelium of the skin and in proliferating B cells of the tonsils.IL-38 binds soluble IL-1 receptor type 1 and may be involved in the modulation of adaptive and innate immune responses. Alone, it does not induce cytokine production but decreases T-cell production of heat-inactivated Candida albicans IL22 and IL17A.IL-38 decreases IL36γ -induced IL8 production by peripheral blood mononuclear cells and increases IL6 production by bacterial lipopolysaccharide (LPS)-stimulated dendritic cells.

Recombinant Human IL-38 is a 16.9 kDa protein containing 152 amino acid residues. This Recombinant Human IL-38 is supplied as Lyophilized powder with high activity, high purity, low endotoxin, and NO labeling. 

Product Properties

Synonyms

Interleukin-38, Interleukin 1 family member 10, IL1F10, FIL1-theta, FKSG75, IL-1HY2, IL1-theta

Source

E.coli-derived human IL-38 protein, Met1-Trp152.

Accession

Q8WWZ1

Molecular Weight

Approximately 16.9kDa, a single non-glycosylated polypeptide chain containing 152 amino acids. 

AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Endotoxin

< 0.01 EU/μg by the LAL method.

Purity

> 97% by SDS-PAGE and HPLC

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.0.

Physical Appearance

Lyophilized powder

Tag

NO

Shipping and Storage

-25 ~ -15 ° C storage, 1 year expiration date after receipt.

After re-solution, store at 2 ~8 °C, 7 days expiration date. After re-dissolution, store at -85~-65°C, 3 months expiration date.

Compounding method

Centrifuge before uncapping to bring contents to the bottom. Reconstitute in NO bacterial distilled water to a concentration of 0.1-1.0 mg/mL, which can be diluted even further according to subsequent experiments; for long term storage, it is recommended that carrier protein (0.1% BSA) be added to the rehydration buffer; dispense for a single experimental dosage, and freeze at -80°C to avoid repeated freezing and thawing. 

Cautions

1. For your safety and health, please wear lab coat and disposable gloves.

2. This product is for scientific research purposes only.

Payment & Security

American Express Apple Pay Diners Club Discover Google Pay Mastercard Visa

Your payment information is processed securely. We do not store credit card details nor have access to your credit card information.

Inquiry

You may also like

FAQ

The product is for research purposes only and is not intended for therapeutic or diagnostic use in humans or animals. Products and content are protected by patents, trademarks, and copyrights owned by Yeasen Biotechnology. Trademark symbols indicate the country of origin, not necessarily registration in all regions.

Certain applications may require additional third-party intellectual property rights.

Yeasen is dedicated to ethical science, believing our research should address critical questions while ensuring safety and ethical standards.