Description
Migration Inhibitory Factor (MIF) is a secreted protein without a cleavable signal sequence and is secreted via a specialized, non-classical pathway. It is secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens. MIF consists of two α-helices and six β-strands, four of which form a β-sheet. The two remaining β-strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position 1. Amino acids 50-65(a.a.) have also been suggested to contain thiol-protein oxidoreductase activity. MIF has proinflammatory cytokine activity centered around (a.a.) 49 - 65. On fibroblasts, MIF induces, IL-1, IL-8 and MMP expression; on macrophages, MIF stimulates NO production and TNF-α release folllowing IFN-γ activation. MIF apparently acts through CD74 and CD44, likely in some form of trimeric interaction. Human MIF is active on mouse cells. Human MIF is 90 %, 94 %, 95 %, and 90 % aa identical to mouse, bovine, porcine and rat MIF, respectively.
Product Properties
|
Synonyms |
GIF Protein, Human; GLIF Protein, Human; MMIF Protein, Human |
|
Accession |
P14174 |
|
GeneID |
4282 |
|
Source |
E.coli-derived Human Macrophage Migration Inhibitory Factor protein, Met-Ala115 |
|
Molecular Weight |
Approximately 12.5 kDa. |
|
AA Sequence |
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
|
Tag |
None |
|
Physical Appearance |
Sterile Filtered White lyophilized (freeze-dried) powder. |
|
Purity |
> 97 % by SDS-PAGE and HPLC analyses. |
|
Biological Activity |
Fully biologically active when compared to standard. The specific activity is determined by binding rhCD74 in a functional ELISA. |
|
Endotoxin |
< 1.0 EU per 1μg of the protein by the LAL method. |
|
Formulation |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
|
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions. |
Shipping and Storage
The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year.
Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.
Cautions
1. Avoid repeated freeze-thaw cycles.
2. For your safety and health, please wear lab coats and disposable gloves for operation.
3. For research use only!
Payment & Security
Your payment information is processed securely. We do not store credit card details nor have access to your credit card information.