Описание
VEGF is a potent growth and angiogenic cytokine. It stimulates the proliferation and survival of endothelial cells and promotes angiogenesis and vascular permeability.VEGF is expressed in vascularized tissues and plays an important role in normal and pathological angiogenesis.VEGF has been implicated in tumor metastasis and in the induction of intraocular neovascularization syndromes.VEGF signals through three types of receptors; fms-like tyrosine kinase (flt-1), the KDR gene product (the murine homolog is the flk-1 gene product) and the flt4 gene product. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two polypeptide chains of 165 amino acids.
This product, Recombinant Human VEGF165, is supplied as a lyophilized powder with high activity, high purity and low endotoxin.
Specification
|
Synonyms |
Human Vascular Endothelial Growth Factor 165; MVCD1, VAS, vascular endothelial growth factor A, VEGF, VEGFA, VPF |
|
Source |
Human VEGF165 Protein is expressed from E.coli without tag. Ala27-Arg191 with an N-terminal Methionine |
|
Accession |
|
|
Molecular Weight |
Approximately 38.2 kDa. |
|
AA Sequence |
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEE SNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDS RCKARQLELNERTCRCDKPRR |
|
Endotoxin |
< 0.01 EU/μg by the LAL method. |
|
Purity |
> 96% by SDS-PAGE and HPLC. |
|
Biological Activity |
Fully biologically active when compared to standard. Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/ml. |
|
Formulation |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
|
Physical Appearance |
White lyophilized powder |
Storage
-25 ~ -15 ° C storage, valid for 1 year after receipt.
After re-solution, store at 2 ~8 °C, 7 days expiration date. After re-dissolution, store at -85~-65°C, 3 months expiration date.
Compounding Methods
Centrifuge before uncapping to bring contents to the bottom. Use sterile distilled water or PBS to re-dissolve and re-formulate to a concentration of 0.1-1.0 mg/mL, which can be diluted even further according to subsequent experiments; for long-term storage, it is recommended that carrier protein (0.1% BSA) be added to the dilution buffer; dispense for a single experimental dosage, and freeze at -80°C to avoid repeated freezing and thawing.
Cautions
1. Please operate with lab coats and disposable gloves,for your safety.
2. This product is for research use only.
Оплата и безопасность
Ваша платежная информация обрабатывается надежно. Мы не храним данные кредитной карты и не имеем доступа к информации вашей кредитной карты.
Расследование
Вам также может понравиться
Часто задаваемые вопросы
Продукт предназначен только для исследовательских целей и не предназначен для терапевтического или диагностического использования на людях или животных. Продукты и содержимое защищены патентами, товарными знаками и авторскими правами, принадлежащими Yeasen Biotechnology. Символы товарных знаков указывают на страну происхождения, а не обязательно на регистрацию во всех регионах.
Для некоторых приложений могут потребоваться дополнительные права интеллектуальной собственности третьих лиц.
Йесен привержен этической науке, полагая, что наши исследования должны затрагивать важнейшие вопросы, обеспечивая при этом безопасность и соблюдение этических стандартов.