인간 IL-38 단백질 _ 90219ES

제품번호: 90219ES05

크기: 2 μg
가격:
판매 가격$137.00

결제 시 배송비 계산

재고:
재고 있음

설명

Interleukin 38 (IL-38) belongs to the IL-1 family and is expressed in fetal skin, spleen, and tonsils, predominantly in the basal epithelium of the skin and in proliferating B cells of the tonsils.IL-38 binds soluble IL-1 receptor type 1 and may be involved in the modulation of adaptive and innate immune responses. Alone, it does not induce cytokine production but decreases T-cell production of heat-inactivated Candida albicans IL22 and IL17A.IL-38 decreases IL36γ -induced IL8 production by peripheral blood mononuclear cells and increases IL6 production by bacterial lipopolysaccharide (LPS)-stimulated dendritic cells.

Recombinant Human IL-38 is a 16.9 kDa protein containing 152 amino acid residues. This Recombinant Human IL-38 is supplied as Lyophilized powder with high activity, high purity, low endotoxin, and NO labeling. 

Product Properties

Synonyms

Interleukin-38, Interleukin 1 family member 10, IL1F10, FIL1-theta, FKSG75, IL-1HY2, IL1-theta

Source

E.coli-derived human IL-38 protein, Met1-Trp152.

Accession

Q8WWZ1

Molecular Weight

Approximately 16.9kDa, a single non-glycosylated polypeptide chain containing 152 amino acids. 

AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Endotoxin

< 0.01 EU/μg by the LAL method.

Purity

> 97% by SDS-PAGE and HPLC

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.0.

Physical Appearance

Lyophilized powder

Tag

NO

Shipping and Storage

-25 ~ -15 ° C storage, 1 year expiration date after receipt.

After re-solution, store at 2 ~8 °C, 7 days expiration date. After re-dissolution, store at -85~-65°C, 3 months expiration date.

Compounding method

Centrifuge before uncapping to bring contents to the bottom. Reconstitute in NO bacterial distilled water to a concentration of 0.1-1.0 mg/mL, which can be diluted even further according to subsequent experiments; for long term storage, it is recommended that carrier protein (0.1% BSA) be added to the rehydration buffer; dispense for a single experimental dosage, and freeze at -80°C to avoid repeated freezing and thawing. 

Cautions

1. For your safety and health, please wear lab coat and disposable gloves.

2. This product is for scientific research purposes only.

결제 및 보안

American Express Apple Pay Diners Club Discover Google Pay Mastercard Visa

귀하의 결제 정보는 안전하게 처리됩니다. 당사는 신용카드 정보를 저장하지 않으며 귀하의 신용카드 정보에 접근할 수 없습니다.

문의

당신은 또한 좋아할 수 있습니다

자주 묻는 질문

이 제품은 연구 목적으로만 사용되며 인간이나 동물의 치료 또는 진단용으로 의도되지 않았습니다. 제품과 콘텐츠는 Yeasen Biotechnology가 소유한 특허, 상표 및 저작권으로 보호됩니다. 상표 기호는 모든 지역에서 반드시 등록되는 것은 아니지만 원산지를 나타냅니다.

특정 애플리케이션에는 추가적인 제3자 지적 재산권이 필요할 수 있습니다.

예슨은 윤리적 과학에 헌신하며, 우리의 연구가 안전과 윤리적 기준을 보장하는 동시에 중요한 문제를 해결해야 한다고 믿습니다.