설명
VEGF is a potent growth and angiogenic cytokine. It stimulates the proliferation and survival of endothelial cells and promotes angiogenesis and vascular permeability.VEGF is expressed in vascularized tissues and plays an important role in normal and pathological angiogenesis.VEGF has been implicated in tumor metastasis and in the induction of intraocular neovascularization syndromes.VEGF signals through three types of receptors; fms-like tyrosine kinase (flt-1), the KDR gene product (the murine homolog is the flk-1 gene product) and the flt4 gene product. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two polypeptide chains of 165 amino acids.
This product, Recombinant Human VEGF165, is supplied as a lyophilized powder with high activity, high purity and low endotoxin.
Specification
Synonyms |
Human Vascular Endothelial Growth Factor 165; MVCD1, VAS, vascular endothelial growth factor A, VEGF, VEGFA, VPF |
Source |
Human VEGF165 Protein is expressed from E.coli without tag. Ala27-Arg191 with an N-terminal Methionine |
Accession |
|
Molecular Weight |
Approximately 38.2 kDa. |
AA Sequence |
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEE SNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDS RCKARQLELNERTCRCDKPRR |
Endotoxin |
< 0.01 EU/μg by the LAL method. |
Purity |
> 96% by SDS-PAGE and HPLC. |
Biological Activity |
Fully biologically active when compared to standard. Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/ml. |
Formulation |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
Physical Appearance |
White lyophilized powder |
Storage
-25 ~ -15 ° C storage, valid for 1 year after receipt.
After re-solution, store at 2 ~8 °C, 7 days expiration date. After re-dissolution, store at -85~-65°C, 3 months expiration date.
Compounding Methods
Centrifuge before uncapping to bring contents to the bottom. Use sterile distilled water or PBS to re-dissolve and re-formulate to a concentration of 0.1-1.0 mg/mL, which can be diluted even further according to subsequent experiments; for long-term storage, it is recommended that carrier protein (0.1% BSA) be added to the dilution buffer; dispense for a single experimental dosage, and freeze at -80°C to avoid repeated freezing and thawing.
Cautions
1. Please operate with lab coats and disposable gloves,for your safety.
2. This product is for research use only.
결제 및 보안
귀하의 결제 정보는 안전하게 처리됩니다. 당사는 신용카드 정보를 저장하지 않으며 귀하의 신용카드 정보에 접근할 수 없습니다.
문의
당신은 또한 좋아할 수 있습니다
자주 묻는 질문
이 제품은 연구 목적으로만 사용되며 인간이나 동물의 치료 또는 진단용으로 의도되지 않았습니다. 제품과 콘텐츠는
특정 애플리케이션에는 추가적인 제3자 지적 재산권이 필요할 수 있습니다.
예슨은 윤리적 과학에 헌신하며, 우리의 연구가 안전과 윤리적 기준을 보장하는 동시에 중요한 문제를 해결해야 한다고 믿습니다.